PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10010460m
Common NameEUTSA_v10010460mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family SRS
Protein Properties Length: 375aa    MW: 38655.3 Da    PI: 7.5444
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10010460mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702232.57e-721382874152
           DUF702   4 gtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasa.aeaaskrkrelkskkqsalsstklssaes 96 
                      +++sCqdCGnqakkdCah+RCRtCCksrgf+C thv+stWvpaakrrerqqqla+ + ++  s+ +++ +kr+re+  +++s+l +t+++++++
  Thhalv10010460m 138 NGVSCQDCGNQAKKDCAHMRCRTCCKSRGFECPTHVRSTWVPAAKRRERQQQLATVQPQTHLSRgDQSVPKRQRENLPATSSSLVCTRVPTHHN 231
                      4679**************************************************9988877766688999************************ PP

           DUF702  97 kkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGl 152
                       + le+ ++P+evss+avfrcvrvssv+dgeee+aYqtavsigGh+fkGiLyd+G+
  Thhalv10010460m 232 ASGLEVGNFPAEVSSPAVFRCVRVSSVEDGEEEFAYQTAVSIGGHIFKGILYDHGA 287
                      *******************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051423.4E-65139287IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016232.0E-27141183IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016244.1E-27240286IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010252Biological Processauxin homeostasis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048479Biological Processstyle development
GO:0048480Biological Processstigma development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 375 aa     Download sequence    Send to blast
MAGFFSLDGG GGGGGGGGGN SQEEHRTNTN PPPPVSESWL WYRNPNVNAN ANANAPSSSN  60
AALGTLELWQ NHNNQEIMFQ HQQHQQRLDL YSSAAGLGVG PSNHSQFDIS GETSNAGAGR  120
AAALMMMRSG GSGGGGGNGV SCQDCGNQAK KDCAHMRCRT CCKSRGFECP THVRSTWVPA  180
AKRRERQQQL ATVQPQTHLS RGDQSVPKRQ RENLPATSSS LVCTRVPTHH NASGLEVGNF  240
PAEVSSPAVF RCVRVSSVED GEEEFAYQTA VSIGGHIFKG ILYDHGAGSS GSGGYNVIAA  300
GESSSAGGGG GAQQLNLITA GSVTVATASS STPNAGGIGS SSAAAATYID PNALYPTPIN  360
TFMAGTQFFP NPRS*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00613PBMTransfer from AT3G51060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006403958.10.0hypothetical protein EUTSA_v10010460mg
SwissprotQ9SD400.0SRS1_ARATH; Protein SHI RELATED SEQUENCE 1
TrEMBLV4NGU30.0V4NGU3_EUTSA; Uncharacterized protein
STRINGBra038880.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34192864
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G51060.11e-160Lateral root primordium (LRP) protein-related